PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026472.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 224aa    MW: 25405.4 Da    PI: 4.7697
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026472.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-13354148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+  ++ +G gt +++a+  g    ++R++k+c++rw +yl
       Do026472.1  3 KGLWSPDEDERLYSHITNYGVGTCSSVAELSGtynwLKRSGKSCRLRWMNYL 54
                     678***********************************************97 PP

2Myb_DNA-binding49.11.3e-1560103146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r + +++E++++v + k+lG++ W++Ia++m+ gRt++++k++w++
       Do026472.1  60 REPISKQEEDRIVSLQKLLGNK-WSAIAARMP-GRTDNEIKNYWNS 103
                      567799****************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.634154IPR017930Myb domain
SMARTSM007178.0E-7256IPR001005SANT/Myb domain
SuperFamilySSF466891.29E-232101IPR009057Homeodomain-like
PfamPF002493.9E-10354IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-16461IPR009057Homeodomain-like
CDDcd001671.52E-6654No hitNo description
PROSITE profilePS5129421.72555109IPR017930Myb domain
SMARTSM007174.8E-1359107IPR001005SANT/Myb domain
PfamPF002492.1E-1361103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2362110IPR009057Homeodomain-like
CDDcd001676.42E-1062102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MRKGLWSPDE DERLYSHITN YGVGTCSSVA ELSGTYNWLK RSGKSCRLRW MNYLQPGLRR  60
EPISKQEEDR IVSLQKLLGN KWSAIAARMP GRTDNEIKNY WNSRIKKKLK RMGASNYNST  120
EMCPTEEKGA DSNTDGGDLD LYTQATMEGQ VDESMTNINS GDDPSPQLPV FACQLLPDPY  180
ATIQSGERTE QSSLNVSFAK SYEINFKEEY VDFLVCLSDD LPEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-23110925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278211e-66KJ727821.1 Zea mays clone pUT5773 MYB-related transcription factor (MYBR4) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669936.18e-78PREDICTED: transcription factor MYB82-like isoform X1
SwissprotP200271e-45MYB3_HORVU; Myb-related protein Hv33
TrEMBLC5Y3I12e-66C5Y3I1_SORBI; Putative uncharacterized protein Sb05g001215 (Fragment)
STRINGSb05g001215.16e-66(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.14e-46myb domain protein 61